• Gene id: 139562

Gene Summary

• Gene Symbol: OTUD6A   Gene   UCSC   Ensembl
• Aliases: DUBA2, HSHIN6
• Gene name: OTU deubiquitinase 6A
• Alternate names: OTU domain-containing protein 6A, HIN-6 protease,
• Gene location: Xq13.1 (70062456: 70064178)     Exons: 1     NC_000023.11
• Gene summary(Entrez): Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA2 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.[supplied by
• OMIM: 606150

Protein Summary

• Protein general information: Q7L8S5  
  • Name: OTU domain containing protein 6A (EC 3.4.19.12) (DUBA 2)
  • Length: 288  
  • Mass: 33300
• Sequence:

  MDDPKSEQQRILRRHQRERQELQAQIRSLKNSVPKTDKTKRKQLLQDVARMEAEMAQKHRQELEKFQDDSSIESV
  VEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEEKLAAILGARGLEMKAIPADG
  HCMYRAIQDQLVFSVSVEMLRCRTASYMKKHVDEFLPFFSNPETSDSFGYDDFMIYCDNIVRTTAWGGQLELRAL
  SHVLKTPIEVIQADSPTLIIGEEYVKKPIILVYLRYAYSLGEHYNSVTPLEAGAAGGVLPRLL

• Structural information:
  • Protein Domains: (141..27-)
    (/note="OTU-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00139"-)
  • Interpro: IPR003323  IPR038765  
  • Prosite: PS50802
  • STRING: ENSP00000339389
• Other Databases: GeneCards:  OTUD6A  Malacards:  OTUD6A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990167	protein K27-linked deubiquitination	IBA	biological process
GO:0035871	protein K11-linked deubiquitination	IBA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IBA	molecular function
GO:1990168	protein K33-linked deubiquitination	IBA	biological process
GO:0035523	protein K29-linked deubiquitination	IBA	biological process
GO:1990167	protein K27-linked deubiquitination	IDA	biological process
GO:0035871	protein K11-linked deubiquitination	IDA	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:1990168	protein K33-linked deubiquitination	IDA	biological process
GO:0035523	protein K29-linked deubiquitination	IDA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881