• Gene id: 139065

Gene Summary

• Gene Symbol: SLITRK4   Gene   UCSC   Ensembl
• Gene name: SLIT and NTRK like family member 4
• Alternate names: SLIT and NTRK-like protein 4, slit and trk like gene 4,
• Gene location: Xq27.3 (143636100: 143622789)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene encodes a transmembrane protein belonging to the the SLITRK family. These family members include two N-terminal leucine-rich repeat domains similar to those found in the axonal growth-controlling protein SLIT, as well as C-terminal regions simil
• OMIM: 300562

Protein Summary

• Protein general information: Q8IW52  
  • Name: SLIT and NTRK like protein 4
  • Length: 837  
  • Mass: 94331
  • Tissue specificity: Expressed in the cerebral cortex of the brain and at higher levels in some astrocytic brain tumors such as astrocytomas, glioblastomas and primitive neuroectodermal tumors. {ECO
• Sequence:

  MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSNFYHLNFQNNFLNILY
  PNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELKILRADTFLGIENLEYLQADYNLIKYIERGA
  FNKLHKLKVLILNDNLISFLPDNIFRFASLTHLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLK
  AWLENMPYNIYIGEAICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLV
  TKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPK
  PLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDVFHNLTNLRRLYLNGNQIERLYPEIFSGLHN
  LQYLYLEYNLIKEISAGTFDSMPNLQLLYLNNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQ
  IDLEGNPWDCTCDLVALKLWVEKLSDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITF
  TTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPDCGSMQLQLRKHDHKT
  NKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVVMRNVADKEKDLLHVDTRKRLSTIDELDELF
  PSRDSNVFIQNFLESKKEYNSIGVSGFEIRYPEKQPDKKSKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYL
  QVLEEQTALNKI

• Structural information:
  • Protein Domains: (213..26-)
    (/note="LRRCT-1)
    (333..37-)
    (/note="LRRNT-)
    (531..58-)
    (/note="LRRCT-2")
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • STRING: ENSP00000469205
• Other Databases: GeneCards:  SLITRK4  Malacards:  SLITRK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007409	axonogenesis	IBA	biological process
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0050807	regulation of synapse organization	IMP	biological process
GO:0050807	regulation of synapse organization	IMP	biological process
GO:0050807	regulation of synapse organization	IDA	biological process
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)