• Gene id: 138715

Gene Summary

• Gene Symbol: ARID3C   Gene   UCSC   Ensembl
• Gene name: AT-rich interaction domain 3C
• Alternate names: AT-rich interactive domain-containing protein 3C, ARID domain-containing protein 3C, AT rich interactive domain 3C (BRIGHT-like), Brightlike,
• Gene location: 9p13.3 (34633111: 34621048)     Exons: 9     NC_000009.12
• Gene summary(Entrez): This gene is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle contr

Protein Summary

• Protein general information: A6NKF2  
  • Name: AT rich interactive domain containing protein 3C (ARID domain containing protein 3C)
  • Length: 412  
  • Mass: 44073
• Sequence:

  MEALQKQQAARLAQGVGPLAPACPLLPPQPPLPDHRTLQAPEGALGNVGAEEEEDAEEDEEKREEAGAEEEAAEE
  SRPGAQGPSSPSSQPPGLHPHEWTYEEQFKQLYELDADPKRKEFLDDLFSFMQKRGTPVNRVPIMAKQVLDLYAL
  FRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECETRALSSPGELQAAIDSNRREGR
  RQAYTATPLFGLAGPPPRGAQDPALGPGPAPPATQSSPGPAQGSTSGLPAHACAQLSPSPIKKEESGIPNPCLAL
  PVGLALGPTREKLAPEEPPEKRAVLMGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING
  VVYTGVLFARRQPVPASQGPTNPAPPPSTGPPSSILP

• Structural information:
  • Protein Domains: (113..20-)
    (/note="ARID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00355-)
    (304..38-)
    (/note="REKLES-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00819"-)
  • Interpro: IPR001606  IPR036431  IPR023334  
  • Prosite: PS51011 PS51486
  • STRING: ENSP00000368189
• Other Databases: GeneCards:  ARID3C  Malacards:  ARID3C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045121	membrane raft	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003682	chromatin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)