• Gene id: 1380

Gene Summary

• Gene Symbol: CR2   Gene   UCSC   Ensembl
• Aliases: C3DR, CD21, CR, CVID7, SLEB9
• Gene name: complement C3d receptor 2
• Alternate names: complement receptor type 2, EBV receptor, complement component (3d/Epstein Barr virus) receptor 2, complement component 3d receptor 2,
• Gene location: 1q32.2 (207454327: 207489891)     Exons: 21     NC_000001.11
• Gene summary(Entrez): This gene encodes a membrane protein, which functions as a receptor for Epstein-Barr virus (EBV) binding on B and T lymphocytes. Genetic variations in this gene are associated with susceptibility to systemic lupus erythematosus type 9 (SLEB9). Alternative

Protein Summary

• Protein general information: P20023  
  • Name: Complement receptor type 2 (Cr2) (Complement C3d receptor) (Epstein Barr virus receptor) (EBV receptor) (CD antigen CD21)
  • Length: 1033  
  • Mass: 112916
  • Tissue specificity: Mature B-lymphocytes, T-lymphocytes, pharyngeal epithelial cells, astrocytes and follicular dendritic cells of the spleen.
• Sequence:

  MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGEKSLLCITKDKVDGTW
  DKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKSVWCQANNMWGPTRLPTCVSVF
  PLECPALPMIHNGHHTSENVGSIAPGLSVTYSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGK
  VKEPPILRVGVTANFFCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSI
  VTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGRMVSGQKDRYTYNDTV
  IFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQKEDRHMVRFDPGTSIKYSCNPGYVLVGEES
  IQCTSEGVWTPPVPQCKVAACEATGRQLLTKPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEI
  TCPPPPVIYNGAHTGSSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAV
  QCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKETCQHVRQSLQELPAG
  SRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCHPPPVIVNGKHTGMMAENFLYGNEVSYECDQ
  GFYLLGEKKLQCRSDSKGHGSWSGPSPQCLRSPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGS
  RVIRCHTDNTWVPGVPTCIKKAFIGCPPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTW
  SQPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDHQWNPPLAVCRSRSLAP
  VLCGIAAGLILLTFLIVITLYVISKHRARNYYTDTSQKEAFHLEAREVYSVDPYNPAS

• Structural information:
  • Protein Domains: (21..8-)
    (/note="Sushi-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (89..14-)
    (/note="Sushi-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (152..21-)
    (/note="Sushi-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (-)
  • Interpro: IPR035976  IPR000436  
  • Prosite: PS50923
  • CDD: cd00033
  • PDB: 1GHQ 1LY2 1W2R 1W2S 2ATY 2GSX 3OED
  • PDBsum: 1GHQ 1LY2 1W2R 1W2S 2ATY 2GSX 3OED
  • STRING: ENSP00000356024
• Other Databases: GeneCards:  CR2  Malacards:  CR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0001618	virus receptor activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0006958	complement activation, classical pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0004875	complement receptor activity	TAS	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030449	regulation of complement activation	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0046718	viral entry into host cell	IEA	biological process
GO:0002430	complement receptor mediated signaling pathway	IEA	biological process
GO:0002430	complement receptor mediated signaling pathway	IEA	biological process
GO:0001848	complement binding	IDA	molecular function
GO:0030183	B cell differentiation	IDA	biological process
GO:0042100	B cell proliferation	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004875	complement receptor activity	NAS	molecular function
GO:0016021	integral component of membrane	NAS	cellular component
GO:0006955	immune response	NAS	biological process
GO:0004888	transmembrane signaling receptor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05169	Epstein-Barr virus infection
hsa04662	B cell receptor signaling pathway
hsa04640	Hematopoietic cell lineage
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Common variable immunodeficiency	KEGG:H00088
Common variable immunodeficiency	KEGG:H00088
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray