• Gene id: 137994

Gene Summary

• Gene Symbol: LETM2   Gene   UCSC   Ensembl
• Aliases: SLC55A2
• Gene name: leucine zipper and EF-hand containing transmembrane protein 2
• Alternate names: LETM1 domain-containing protein LETM2, mitochondrial, LETM1 and EF-hand domain-containing protein 2, leucine zipper-EF-hand containing transmembrane protein 1-like protein, leucine zipper-EF-hand containing transmembrane protein 2,
• Gene location: 8p11.23 (38382504: 38409526)     Exons: 17     NC_000008.11
• OMIM: 0

Protein Summary

• Protein general information: Q2VYF4  
  • Name: LETM1 domain containing protein LETM2, mitochondrial (LETM1 and EF hand domain containing protein 2) (Leucine zipper EF hand containing transmembrane protein 1 like)
  • Length: 491  
  • Mass: 55921
• Sequence:

  MAFYSYNSVLAIARTRFPSHFVHPTCSSYSPSCAFLHLPDSHLNKTCMKNYESKKYSDPSQPGNTVLHPGTRLIQ
  KLHTSTCWLQEVPGKPQLEQATKHPQVTSPQATKETGMEIKEGKQSYRQKIMDELKYYYNGFYLLWIDAKVAARM
  VWRLLHGQVLTRRERRRLLRTCVDFFRLVPFMVFLIVPFMEFLLPVFLKLFPEMLPSTFESESKKEEKQKKKMAV
  KLELAKFLQETMTEMARRNRAKMGDASTQLSSYVKQVQTGHKPSTKEIVRFSKLFEDQLALEHLDRPQLVALCKL
  LELQTFGTNNLLRFQLLMKLKSIKADDEIIAKEGVTALSVSELQAACRARGMRSLGLTEEQLRQQLTEWQDLHLK
  ENVPPSLLLLSRTFYLIDVKPKPIEIPLSGEAPKTDILVELPTFTESKENMVDLAPQLKGTKDEDFIQPPPVTSS
  PITPSTPISLPKGPITSSEEPTLQAKSQMTAQNSKASSKGA

• Structural information:
  • Protein Domains: (221..43-)
    (/note="Letm1-RBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01094"-)
  • Interpro: IPR011685  IPR033122  
  • Prosite: PS51758
  • STRING: ENSP00000369291
• Other Databases: GeneCards:  LETM2  Malacards:  LETM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006875	cellular metal ion homeostasis	IBA	biological process
GO:0043022	ribosome binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881