• Gene id: 137735

Gene Summary

• Gene Symbol: ABRA   Gene   UCSC   Ensembl
• Aliases: STARS
• Gene name: actin binding Rho activating protein
• Alternate names: actin-binding Rho-activating protein, striated muscle activator of Rho-dependent signaling,
• Gene location: 8q23.1 (106809072: 106759482)     Exons: 4     NC_000008.11
• OMIM: 609747

Protein Summary

• Protein general information: Q8N0Z2  
  • Name: Actin binding Rho activating protein (Striated muscle activator of Rho dependent signaling) (STARS)
  • Length: 381  
  • Mass: 43117
• Sequence:

  MAPGEKESGEGPAKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSPQAPKPITPPTSHQKA
  QSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKTVVSKTYERGGDVSHLSHRYERDAGVLEPGQPENDIDRI
  LHSHGSPTRRRKCANLVSELTKGWRVMEQEEPTWRSDSVDTEDSGYGGEAEERPEQDGVQVAVVRIKRPLPSQVN
  RFTEKLNCKAQQKYSPVGNLKGRWQQWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK
  RAEEHIYREMMDMCFIICTMARHRRDGKIQVTFGDLFDRYVRISDKVVGILMRARKHGLVDFEGEMLWQGRDDHV
  VITLLK

• Structural information:
  • Interpro: IPR026111  IPR027817  IPR038095  
  • STRING: ENSP00000311436
• Other Databases: GeneCards:  ABRA  Malacards:  ABRA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003779	actin binding	ISS	molecular function
GO:0015629	actin cytoskeleton	ISS	cellular component
GO:0035025	positive regulation of Rho protein signal transduction	ISS	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0030017	sarcomere	ISS	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IBA	biological process
GO:0030017	sarcomere	IBA	cellular component
GO:0035025	positive regulation of Rho protein signal transduction	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IBA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0035025	positive regulation of Rho protein signal transduction	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0030017	sarcomere	IEA	cellular component
GO:0051091	positive regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	IEA	biological process
GO:0030016	myofibril	IEA	cellular component
GO:0006606	protein import into nucleus	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0030017	sarcomere	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)