• Gene id: 1370

Gene Summary

• Gene Symbol: CPN2   Gene   UCSC   Ensembl
• Aliases: ACBP
• Gene name: carboxypeptidase N subunit 2
• Alternate names: carboxypeptidase N subunit 2, arginine carboxypeptidase, carboxypeptidase N 83 kDa chain, carboxypeptidase N large subunit, carboxypeptidase N regulatory subunit, carboxypeptidase N, polypeptide 2, 83kD,
• Gene location: 3q29 (194351386: 194339764)     Exons: 3     NC_000003.12
• OMIM: 603350

Protein Summary

• Protein general information: P22792  
  • Name: Carboxypeptidase N subunit 2 (Carboxypeptidase N 83 kDa chain) (Carboxypeptidase N large subunit) (Carboxypeptidase N polypeptide 2) (Carboxypeptidase N regulatory subunit)
  • Length: 545  
  • Mass: 60557
• Sequence:

  MLPGAWLLWTSLLLLARPAQPCPMGCDCFVQEVFCSDEELATVPLDIPPYTKNIIFVETSFTTLETRAFGSNPNL
  TKVVFLNTQLCQFRPDAFGGLPRLEDLEVTGSSFLNLSTNIFSNLTSLGKLTLNFNMLEALPEGLFQHLAALESL
  HLQGNQLQALPRRLFQPLTHLKTLNLAQNLLAQLPEELFHPLTSLQTLKLSNNALSGLPQGVFGKLGSLQELFLD
  SNNISELPPQVFSQLFCLERLWLQRNAITHLPLSIFASLGNLTFLSLQWNMLRVLPAGLFAHTPCLVGLSLTHNQ
  LETVAEGTFAHLSNLRSLMLSYNAITHLPAGIFRDLEELVKLYLGSNNLTALHPALFQNLSKLELLSLSKNQLTT
  LPEGIFDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTDRLLNIQTYCAGPAYLKGQVVPALNEKQLVCPVTRD
  HLGFQVTWPDESKAGGSWDLAVQERAARSQCTYSNPEGTVVLACDQAQCRWLNVQLSPQQGSLGLQYNASQEWDL
  RSSCGSLRLTVSIEARAAGP

• Structural information:
  • Protein Domains: (22..4-)
    (/note="LRRNT-)
    (395..44-)
    (/note="LRRCT"-)
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS51450
  • STRING: ENSP00000319464
• Other Databases: GeneCards:  CPN2  Malacards:  CPN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031012	extracellular matrix	IBA	cellular component
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0030449	regulation of complement activation	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0050821	protein stabilization	NAS	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0030234	enzyme regulator activity	NAS	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R