• Gene id: 136541

Gene Summary

• Gene Symbol: PRSS58   Gene   UCSC   Ensembl
• Aliases: PRSS1, TRY1, TRYX3, UNQ2540
• Gene name: serine protease 58
• Alternate names: serine protease 58, protease, serine 58, trypsin-X3,
• Gene location: 7q34 (142258057: 142252142)     Exons: 12     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the trypsin family of serine proteases. This gene and several related trypsinogen genes are localized to the T cell receptor beta locus on chromosome 7. This gene was previously described as a trypsinogen-like pseudogene, but

Protein Summary

• Protein general information: Q8IYP2  
  • Name: Serine protease 58 (EC 3.4.21.4) (Trypsin X3)
  • Length: 241  
  • Mass: 27085
• Sequence:

  MKFILLWALLNLTVALAFNPDYTVSSTPPYLVYLKSDYLPCAGVLIHPLWVITAAHCNLPKLRVILGVTIPADSN
  EKHLQVIGYEKMIHHPHFSVTSIDHDIMLIKLKTEAELNDYVKLANLPYQTISENTMCSVSTWSYNVCDIYKEPD
  SLQTVNISVISKPQCRDAYKTYNITENMLCVGIVPGRRQPCKEVSAAPAICNGMLQGILSFADGCVLRADVGIYA
  KIFYYIPWIENVIQNN

• Structural information:
  • Protein Domains: (18..23-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  
  • Prosite: PS50240 PS00134
  • CDD: cd00190
  • STRING: ENSP00000446916
• Other Databases: GeneCards:  PRSS58  Malacards:  PRSS58

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Male infertility	MIK: 18367176
Non obstructive azoospermia	MIK: 24012201

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
18367176	Male infertility				Male infertility	Microarray