• Gene id: 135941

Gene Summary

• Gene Symbol: OR2A14   Gene   UCSC   Ensembl
• Aliases: OR2A14P, OR2A6, OST182
• Gene name: olfactory receptor family 2 subfamily A member 14
• Alternate names: olfactory receptor 2A14, olfactory receptor 2A6, olfactory receptor OR7-12, olfactory receptor, family 2, subfamily A, member 14 pseudogene, olfactory receptor, family 2, subfamily A, member 6,
• Gene location: 7q35 (144129057: 144130146)     Exons: 1     NC_000007.14
• Gene summary(Entrez): Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from sing
• OMIM: 615054

Protein Summary

• Protein general information: Q96R47  
  • Name: Olfactory receptor 2A14 (OST182) (Olfactory receptor 2A6) (Olfactory receptor OR7 12)
  • Length: 310  
  • Mass: 34993
• Sequence:

  MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYFFLSHLAIVDISYASN
  YVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYDRYADICHPLRYNSLMSWRVCTVLAVASWVF
  SFLLALVPLVLILSLPFCGPHEINHFFCEILSVLKLACADTWLNQVVIFAACVFILVGPLCLVLVSYLRILAAIL
  RIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGAL
  RRALRKERLT

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000725  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000386137
• Other Databases: GeneCards:  OR2A14  Malacards:  OR2A14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0004984	olfactory receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007608	sensory perception of smell	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050911	detection of chemical stimulus involved in sensory perception of smell	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04740	Olfactory transduction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq