• Gene id: 1357

Gene Summary

• Gene Symbol: CPA1   Gene   UCSC   Ensembl
• Aliases: CPA
• Gene name: carboxypeptidase A1
• Alternate names: carboxypeptidase A1, carboxypeptidase A1 (pancreatic), pancreatic carboxypeptidase A,
• Gene location: 7q32.2 (130380493: 130388107)     Exons: 10     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family
• OMIM: 615393

Protein Summary

• Protein general information: P15085  
  • Name: Carboxypeptidase A1 (EC 3.4.17.1)
  • Length: 419  
  • Mass: 47140
• Sequence:

  MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAV
  KIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGN
  TYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDG
  FAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIK
  AFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKY
  SFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHPY

• Structural information:
  • Interpro: IPR034248  IPR036990  IPR003146  IPR000834  
  • Prosite: PS00132 PS00133
  • CDD: cd03870
  • PDB: 2V77 3FJU 4UEE 4UEF 4UEZ 4UF4 5OM9 6I6Z
  • PDBsum: 2V77 3FJU 4UEE 4UEF 4UEZ 4UF4 5OM9 6I6Z
  • DIP: 48699
  • STRING: ENSP00000011292
• Other Databases: GeneCards:  CPA1  Malacards:  CPA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006508	proteolysis	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0004181	metallocarboxypeptidase activity	IBA	molecular function
GO:0006691	leukotriene metabolic process	ISS	biological process
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0008237	metallopeptidase activity	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	TAS	molecular function
GO:0006508	proteolysis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008238	exopeptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005615	extracellular space	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04974	Protein digestion and absorption
hsa04972	Pancreatic secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881