• Gene id: 133746

Gene Summary

• Gene Symbol: JMY   Gene   UCSC   Ensembl
• Aliases: WHAMM2, WHDC1L3
• Gene name: junction mediating and regulatory protein, p53 cofactor
• Alternate names: junction-mediating and -regulatory protein, WAS protein homology region 2 domain containing 1-like 3,
• Gene location: 5q14.1 (22272912: 22274460)     Exons: 1     NC_000023.11
• OMIM: 604279

Protein Summary

• Protein general information: Q8N9B5  
  • Name: Junction mediating and regulatory protein
  • Length: 988  
  • Mass: 111445
• Sequence:

  MSFALEETLESDWVAVRPHVFDEREKHKFVFIVAWNEIEGKFAITCHNRTAQRQRSGSREQAGARGGAEAGGAAS
  DGSRGPGSPAGRGRPEATASATLVRSPGPRRSSAWAEGGSPRSTRSLLGDPRLRSPGSKGAESRLRSPVRAKPIP
  GQKTSEADDAAGAAAAAARPAPREAQVSSVRIVSASGTVSEEIEVLEMVKEDEAPLALSDAEQPPPATELESPAE
  ECSWAGLFSFQDLRAVHQQLCSVNSQLEPCLPVFPEEPSGMWTVLFGGAPEMTEQEIDTLCYQLQVYLGHGLDTC
  GWKILSQVLFTETDDPEEYYESLSELRQKGYEEVLQRARKRIQELLDKHKNTESMVELLDLYQMEDEAYSSLAEA
  TTELYQYLLQPFRDMRELAMLRRQQIKISMENDYLGPRRIESLQKEDADWQRKAHMAVLSIQDLTVKYFEITAKA
  QKAVYDRMRADQKKFGKASWAAAAERMEKLQYAVSKETLQMMRAKEICLEQRKHALKEEMQSLRGGTEAIARLDQ
  LEADYYDLQLQLYEVQFEILKCEELLLTAQLESIKRLISEKRDEVVYYDTYESMEAMLEKEEMAASAYLQREELQ
  KLQQKARQLEARRGRVSAKKSYLRNKKEICIAKHNEKIQQRTRIEDEYRTHHTVQLKREKLHDEEERKSAWVSQE
  RQRTLDRLRTFKQRYPGQVILKSTRLRLAHARRKGAASPVLQEDHCDSLPSVLQVEEKTEEVGEGRVKRGPSQTT
  EPQSLVQLEDTSLTQLEATSLPLSGVTSELPPTISLPLLNNNLEPCSVTINPLPSPLPPTPPPPPPPPPPPPPPP
  LPVAKDSGPETLEKDLPRKEGNEKRIPKSASAPSAHLFDSSQLVSARKKLRKTAEGLQRRRVSSPMDEVLASLKR
  GSFHLKKVEQRTLPPFPDEDDSNNILAQIRKGVKLKKVQKDVLRESFTLLPDTDPLTRSIHEALRRIKEASPESE
  DEEEALPCTDWEN

• Structural information:
  • Protein Domains: (921..93-)
    (/note="WH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00406"-)
  • Interpro: IPR033324  IPR031738  IPR031808  IPR003124  
  • Prosite: PS51082
  • STRING: ENSP00000379441
• Other Databases: GeneCards:  JMY  Malacards:  JMY

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006357	regulation of transcription by RNA polymerase II	ISS	biological process
GO:0003713	transcription coactivator activity	ISS	molecular function
GO:0007050	cell cycle arrest	IBA	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	IBA	biological process
GO:0070060	'de novo' actin filament nucleation	IBA	biological process
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	IBA	biological process
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IBA	biological process
GO:0071933	Arp2/3 complex binding	IBA	molecular function
GO:0031252	cell leading edge	IDA	cellular component
GO:0070060	'de novo' actin filament nucleation	ISS	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	ISS	biological process
GO:0070358	actin polymerization-dependent cell motility	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0034314	Arp2/3 complex-mediated actin nucleation	IEA	biological process
GO:0070060	'de novo' actin filament nucleation	IEA	biological process
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:1903508	positive regulation of nucleic acid-templated transcription	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007050	cell cycle arrest	ISS	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	ISS	biological process
GO:0043065	positive regulation of apoptotic process	ISS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)