• Gene id: 133418

Gene Summary

• Gene Symbol: EMB   Gene   UCSC   Ensembl
• Aliases: GP70
• Gene name: embigin
• Alternate names: embigin, embigin homolog,
• Gene location: 5q11.1 (50443298: 50396191)     Exons: 11     NC_000005.10
• Gene summary(Entrez): This gene encodes a transmembrane glycoprotein that is a member of the immunoglobulin superfamily. The encoded protein may be involved in cell growth and development by mediating interactions between the cell and extracellular matrix. A pseudogene of this
• OMIM: 604575

Protein Summary

• Protein general information: Q6PCB8  
  • Name: Embigin
  • Length: 327  
  • Mass: 36881
• Sequence:

  MRALPGLLEARARTPRLLLLQCLLAAARPSSADGSAPDSPFTSPPLREEIMANNFSLESHNISLTEHSSMPVEKN
  ITLERPSNVNLTCQFTTSGDLNAVNVTWKKDGEQLENNYLVSATGSTLYTQYRFTIINSKQMGSYSCFFREEKEQ
  RGTFNFKVPELHGKNKPLISYVGDSTVLTCKCQNCFPLNWTWYSSNGSVKVPVGVQMNKYVINGTYANETKLKIT
  QLLEEDGESYWCRALFQLGESEEHIELVVLSYLVPLKPFLVIVAEVILLVATILLCEKYTQKKKKHSDEGKEFEQ
  IEQLKSDDSNGIENNVPRHRKNESLGQ

• Structural information:
  • Protein Domains: (71..15-)
    1 (/note="Ig-like-V-type)
    (159..25-)
    2" (/note="Ig-like-V-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013098  IPR003599   IPR013151  
  • Prosite: PS50835
  • STRING: ENSP00000302289
• Other Databases: GeneCards:  EMB  Malacards:  EMB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030424	axon	IBA	cellular component
GO:0070593	dendrite self-avoidance	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IBA	biological process
GO:0007411	axon guidance	IBA	biological process
GO:0098632	cell-cell adhesion mediator activity	IBA	molecular function
GO:0035879	plasma membrane lactate transport	ISS	biological process
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881