• Gene id: 133308

Gene Summary

• Gene Symbol: SLC9B2   Gene   UCSC   Ensembl
• Aliases: NHA2, NHE10, NHEDC2
• Gene name: solute carrier family 9 member B2
• Alternate names: sodium/hydrogen exchanger 9B2, NHE domain-containing protein 2, Na(+)/H(+) exchanger NHA2, Na(+)/H(+) exchanger-like domain-containing protein 2, Na+/H+ exchanger domain containing 2, mitochondrial Na(+)/H(+) exchanger NHA2, mitochondrial sodium/hydrogen exchan,
• Gene location: 4q24 (103077318: 103018028)     Exons: 7     NC_000004.12
• Gene summary(Entrez): Sodium hydrogen antiporters, such as NHEDC2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell
• OMIM: 611789

Protein Summary

• Protein general information: Q86UD5  
  • Name: Sodium/hydrogen exchanger 9B2 (Na(+)/H(+) exchanger NHA2) (Na(+)/H(+) exchanger like domain containing protein 2) (NHE domain containing protein 2) (Sodium/hydrogen exchanger like domain containing protein 2) (Solute carrier family 9 subfamily B member 2)
  • Length: 537  
  • Mass: 57564
  • Tissue specificity: Widely expressed (PubMed
• Sequence:

  MGDEDKRITYEDSEPSTGMNYTPSMHQEAQEETVMKLKGIDANEPTEGSILLKSSEKKLQETPTEANHVQRLRQM
  LACPPHGLLDRVITNVTIIVLLWAVVWSITGSECLPGGNLFGIIILFYCAIIGGKLLGLIKLPTLPPLPSLLGML
  LAGFLIRNIPVINDNVQIKHKWSSSLRSIALSIILVRAGLGLDSKALKKLKGVCVRLSMGPCIVEACTSALLAHY
  LLGLPWQWGFILGFVLGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTV
  FNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLAVFSSVHFGFPGSGGLCTLVMAFLAG
  MGWTSEKAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGLCVATVGIAVLIRILTTFLMVCFAGFNLKEK
  IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILITAPIGSLLIGLLGPRLLQKVEHQNK
  DEEVQGETSVQV

• Structural information:
  • Interpro: IPR006153  IPR038770  IPR037072  
  • STRING: ENSP00000378265
• Other Databases: GeneCards:  SLC9B2  Malacards:  SLC9B2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0015672	monovalent inorganic cation transport	IBA	biological process
GO:0006814	sodium ion transport	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0031966	mitochondrial membrane	IDA	cellular component
GO:0015385	sodium:proton antiporter activity	IMP	molecular function
GO:0010348	lithium:proton antiporter activity	IMP	molecular function
GO:0097228	sperm principal piece	ISS	cellular component
GO:0015385	sodium:proton antiporter activity	IMP	molecular function
GO:0010348	lithium:proton antiporter activity	IMP	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0030317	flagellated sperm motility	ISS	biological process
GO:0006812	cation transport	IEA	biological process
GO:0006814	sodium ion transport	IEA	biological process
GO:0015299	solute:proton antiporter activity	IEA	molecular function
GO:0015385	sodium:proton antiporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0055085	transmembrane transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0015297	antiporter activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0006814	sodium ion transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031514	motile cilium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0034220	ion transmembrane transport	TAS	biological process
GO:0005451	monovalent cation:proton antiporter activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097228	sperm principal piece	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0097708	intracellular vesicle	IEA	cellular component
GO:2001206	positive regulation of osteoclast development	IEA	biological process
GO:0072583	clathrin-dependent endocytosis	IEA	biological process
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0030317	flagellated sperm motility	IEA	biological process
GO:0010008	endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process
GO:0035725	sodium ion transmembrane transport	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray