• Gene id: 132954

Gene Summary

• Gene Symbol: PDCL2   Gene   UCSC   Ensembl
• Aliases: GCPHLP
• Gene name: phosducin like 2
• Alternate names: phosducin-like protein 2,
• Gene location: 4q12 (55592273: 55556518)     Exons: 7     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the phosducin-like protein family and is a putative modulator of heterotrimeric G proteins. The protein shares extensive amino acid sequence homology with phosducin. Members of the phosducin-like protein family have been show
• OMIM: 611676

Protein Summary

• Protein general information: Q8N4E4  
  • Name: Phosducin like protein 2
  • Length: 241  
  • Mass: 28071
• Sequence:

  MQDPNEDTEWNDILRDFGILPPKEESKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDEFDEEDMQAVETYRKK
  RLQEWKALKKKQKFGELREISGNQYVNEVTNAEEDVWVIIHLYRSSIPMCLLVNQHLSLLARKFPETKFVKAIVN
  SCIQHYHDNCLPTIFVYKNGQIEAKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEENPRKDMVDMMVSSIRNT
  SIHDDSDSSNSDNDTK

• Structural information:
  • Interpro: IPR024253  IPR036249  
  • PDB: 3EVI
  • PDBsum: 3EVI
  • STRING: ENSP00000295645
• Other Databases: GeneCards:  PDCL2  Malacards:  PDCL2

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)