|
Gene id |
132946 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
ARL9 Gene UCSC Ensembl |
|
Gene name |
ADP ribosylation factor like GTPase 9 |
|
Alternate names |
ADP-ribosylation factor-like protein 9, ADP-ribosylation factor-like 9, |
|
Gene location |
4q12 (97928440: 97851676) Exons: 16 NC_000007.14
|
|
Gene summary(Entrez) |
ARL9 is a member of the small GTPase protein family with a high degree of similarity to ARF (MIM 103180) proteins of the RAS superfamily.[supplied by OMIM, Nov 2008]
|
|
OMIM |
612405 |
Protein Summary
|
| Protein general information
| Q6T311
Name: ADP ribosylation factor like protein 9
Length: 187 Mass: 20755
|
| Sequence |
MRPTWKALSHPAWPEEKNKQILVLGLDGAGKTSVLHSLASNRVQHSVAPTQGFHAVCINTEDSQMEFLEIGGSKP FRSYWEMYLSKGLLLIFVVDSADHSRLPEAKKYLHQLIAANPVLPLVVFANKQDLEAAYHITDIHEALALSEVGN DRKMFLFGTYLTKNGSEIPSTMQDAKDLIAQLAADVQ
|
| Structural information |
|
| Other Databases |
GeneCards: ARL9  Malacards: ARL9 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0005525 |
GTP binding
|
IEA |
molecular function |
GO:0000166 |
nucleotide binding
|
IEA |
molecular function |
GO:0005525 |
GTP binding
|
IEA |
molecular function |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|