• Gene id: 132864

Gene Summary

• Gene Symbol: CPEB2   Gene   UCSC   Ensembl
• Aliases: CPE-BP2, CPEB-2, hCPEB-2
• Gene name: cytoplasmic polyadenylation element binding protein 2
• Alternate names: cytoplasmic polyadenylation element-binding protein 2, CPE-binding protein 2,
• Gene location: 4p15.32 (15002425: 15070152)     Exons: 16     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the
• OMIM: 610605

Protein Summary

• Protein general information: Q7Z5Q1  
  • Name: Cytoplasmic polyadenylation element binding protein 2 (CPE BP2) (CPE binding protein 2) (hCPEB 2)
  • Length: 589  
  • Mass: 64944
• Sequence:

  MPPPSPDSENGFYPGLPSSMNPAFFPSFSPVSPHGCTGLSVPTSGGGGGGFGGPFSATAVPPPPPPAMNIPQQQP
  PPPAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRR
  TGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRSSLQLPAWGSDS
  LQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRSSLFPIDDGL
  LDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPK
  GYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRP
  LRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQ
  MCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN

• Structural information:
  • Protein Domains: (332..42-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (440..52-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR032296  IPR038446  IPR034819  IPR012677  IPR035979   IPR000504  
  • Prosite: PS50102
  • STRING: ENSP00000443985
• Other Databases: GeneCards:  CPEB2  Malacards:  CPEB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043022	ribosome binding	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0008135	translation factor activity, RNA binding	IBA	molecular function
GO:2000766	negative regulation of cytoplasmic translation	IBA	biological process
GO:1990124	messenger ribonucleoprotein complex	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0000900	translation repressor activity, mRNA regulatory element binding	IBA	molecular function
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:0032869	cellular response to insulin stimulus	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:1900248	negative regulation of cytoplasmic translational elongation	ISS	biological process
GO:1900248	negative regulation of cytoplasmic translational elongation	ISS	biological process
GO:0043022	ribosome binding	ISS	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	ISS	molecular function
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0034260	negative regulation of GTPase activity	ISS	biological process
GO:2000766	negative regulation of cytoplasmic translation	IMP	biological process
GO:1990124	messenger ribonucleoprotein complex	ISS	cellular component
GO:1990124	messenger ribonucleoprotein complex	ISS	cellular component
GO:0071243	cellular response to arsenic-containing substance	ISS	biological process
GO:0071243	cellular response to arsenic-containing substance	ISS	biological process
GO:0043024	ribosomal small subunit binding	ISS	molecular function
GO:0043023	ribosomal large subunit binding	ISS	molecular function
GO:0005095	GTPase inhibitor activity	ISS	molecular function
GO:0000900	translation repressor activity, mRNA regulatory element binding	ISS	molecular function
GO:0000900	translation repressor activity, mRNA regulatory element binding	ISS	molecular function
GO:0000900	translation repressor activity, mRNA regulatory element binding	ISS	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0045182	translation regulator activity	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04114	Oocyte meiosis
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)