• Gene id: 132112

Gene Summary

• Gene Symbol: RTP1   Gene   UCSC   Ensembl
• Aliases: Z3CXXC1
• Gene name: receptor transporter protein 1
• Alternate names: receptor-transporting protein 1, 3CxxC-type zinc finger protein 1, receptor (chemosensory) transporter protein 1, zinc finger, 3CxxC-type 1,
• Gene location: 3q27.3 (187197485: 187201461)     Exons: 2     NC_000003.12
• OMIM: 607806

Protein Summary

• Protein general information: P59025  
  • Name: Receptor transporting protein 1 (3CxxC type zinc finger protein 1)
  • Length: 263  
  • Mass: 30913
  • Tissue specificity: Expressed in testis. {ECO
• Sequence:

  MRIFRPWRLRCPALHLPSLSVFSLRWKLPSLTTDETMCKSVTTDEWKKVFYEKMEEAKPADSWDLIIDPNLKHNV
  LSPGWKQYLELHASGRFHCSWCWHTWQSPYVVILFHMFLDRAQRAGSVRMRVFKQLCYECGTARLDESSMLEENI
  EGLVDNLITSLREQCYGERGGQYRIHVASRQDNRRHRGEFCEACQEGIVHWKPSEKLLEEEATTYTFSRAPSPTK
  SQDQTGSGWNFCSIPWCLFWATVLLLIIYLQFSFRSSV

• Structural information:
  • Interpro: IPR026096  IPR026692  IPR027377  
  • STRING: ENSP00000311712
• Other Databases: GeneCards:  RTP1  Malacards:  RTP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031849	olfactory receptor binding	IMP	molecular function
GO:0051205	protein insertion into membrane	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0051205	protein insertion into membrane	IBA	biological process
GO:0001580	detection of chemical stimulus involved in sensory perception of bitter taste	IBA	biological process
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0009986	cell surface	IBA	cellular component
GO:0031849	olfactory receptor binding	IBA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq