• Gene id: 132001

Gene Summary

• Gene Symbol: TAMM41   Gene   UCSC   Ensembl
• Aliases: C3orf31, RAM41, TAM41
• Gene name: TAM41 mitochondrial translocator assembly and maintenance homolog
• Alternate names: phosphatidate cytidylyltransferase, mitochondrial, CDP-DAG synthase, CDP-diacylglycerol synthase, MMP37-like protein, mitochondrial, TAM41, mitochondrial translocator assembly and maintenance protein, homolog, mitochondrial translocator assembly and maintenanc,
• Gene location: 3p25.2 (11846899: 11721895)     Exons: 18     NC_000003.12
• OMIM: 614948

Protein Summary

• Protein general information: Q96BW9  
  • Name: Phosphatidate cytidylyltransferase, mitochondrial (EC 2.7.7.41) (CDP diacylglycerol synthase) (CDP DAG synthase) (Mitochondrial translocator assembly and maintenance protein 41 homolog) (TAM41)
  • Length: 452  
  • Mass: 51067
• Sequence:

  MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSF
  LKVLGPKIITSIQNNYGAGVYYNSLIMCNGRLIKYGVISTNVLIEDLLNWNNLYIAGRLQKPVKIISVNEDVTLR
  SALDRNLKSAVTAAFLMLPESFSEEDLFIEIAGLSYSGDFRMVVGEDKTKVLNIVKPNIAHFRELYGSILQENPQ
  VVYKSQQGWLEIDKSPEGQFTQLMTLPKTLQQQINHIMDPPGKNRDVEETLFQVAHDPDCGDVVRLGLSAIVRPS
  SIRQSTKGIFTAGKSFGNPCVTYLLTEWLPHSWLQCKALYLLGACEMLSFDGHKLGYCSKVQTGITAAEPGGRTM
  SDHWQCCWKLYCPSEFSETLPVCRVFPSYCFIYQSYRCIGLQKQQHLCSPSSSPSLRQLLPSVLVGYFCCYCHFS
  KW

• Structural information:
  • Interpro: IPR015222  
  • STRING: ENSP00000398596
• Other Databases: GeneCards:  TAMM41  Malacards:  TAMM41

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004605	phosphatidate cytidylyltransferase activity	ISS	molecular function
GO:0032049	cardiolipin biosynthetic process	ISS	biological process
GO:0019898	extrinsic component of membrane	ISS	cellular component
GO:0004605	phosphatidate cytidylyltransferase activity	ISS	molecular function
GO:0005743	mitochondrial inner membrane	ISS	cellular component
GO:0004605	phosphatidate cytidylyltransferase activity	IEA	molecular function
GO:0032049	cardiolipin biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0004605	phosphatidate cytidylyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0019898	extrinsic component of membrane	IEA	cellular component
GO:0004605	phosphatidate cytidylyltransferase activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016024	CDP-diacylglycerol biosynthetic process	IEA	biological process
GO:0031314	extrinsic component of mitochondrial inner membrane	ISS	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)