• Gene id: 131601

Gene Summary

• Gene Symbol: TPRA1   Gene   UCSC   Ensembl
• Aliases: GPR175, TMEM227, TPRA40
• Gene name: transmembrane protein adipocyte associated 1
• Alternate names: transmembrane protein adipocyte-associated 1, G protein-coupled receptor 175, integral membrane protein GPR175, seven transmembrane domain orphan receptor, transmembrane domain protein regulated in adipocytes 40 kDa, transmembrane protein 227, transmembrane pro,
• Gene location: 3q21.3 (127598230: 127571231)     Exons: 18     NC_000003.12
• OMIM: 180073

Protein Summary

• Protein general information: Q86W33  
  • Name: Transmembrane protein adipocyte associated 1 (Integral membrane protein GPR175) (Transmembrane protein 227)
  • Length: 373  
  • Mass: 41053
  • Tissue specificity: Ubiquitous, with higher levels in heart, placenta and kidney. {ECO
• Sequence:

  MDTLEEVTWANGSTALPPPLAPNISVPHRCLLLLYEDIGTSRVRYWDLLLLIPNVLFLIFLLWKLPSARAKIRIT
  SSPIFITFYILVFVVALVGIARAVVSMTVSTSNAATVADKILWEITRFFLLAIELSVIILGLAFGHLESKSSIKR
  VLAITTVLSLAYSVTQGTLEILYPDAHLSAEDFNIYGHGGRQFWLVSSCFFFLVYSLVVILPKTPLKERISLPSR
  RSFYVYAGILALLNLLQGLGSVLLCFDIIEGLCCVDATTFLYFSFFAPLIYVAFLRGFFGSEPKILFSYKCQVDE
  TEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAINA

• Structural information:
  • Interpro: IPR018781  
  • STRING: ENSP00000347748
• Other Databases: GeneCards:  TPRA1  Malacards:  TPRA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0006629	lipid metabolic process	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0007568	aging	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0040016	embryonic cleavage	IEA	biological process
GO:1901991	negative regulation of mitotic cell cycle phase transition	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881