• Gene id: 131566

Gene Summary

• Gene Symbol: DCBLD2   Gene   UCSC   Ensembl
• Aliases: CLCP1, ESDN
• Gene name: discoidin, CUB and LCCL domain containing 2
• Alternate names: discoidin, CUB and LCCL domain-containing protein 2, 1700055P21Rik, CUB, LCCL and coagulation factor V/VIII-homology domains protein 1, coagulation factor V/VIII-homology domains protein 1, endothelial and smooth muscle cell-derived neuropilin-like protein,
• Gene location: 3 (98901694: 98795940)     Exons: 18     NC_000003.12
• OMIM: 608698

Protein Summary

• Protein general information: Q96PD2  
  • Name: Discoidin, CUB and LCCL domain containing protein 2 (CUB, LCCL and coagulation factor V/VIII homology domains protein 1) (Endothelial and smooth muscle cell derived neuropilin like protein)
  • Length: 775  
  • Mass: 85035
  • Tissue specificity: Highly expressed in testis, heart, skeletal muscle and also in cultured vascular smooth muscle cells. {ECO
• Sequence:

  MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGDGCGHT
  VLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGL
  GLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGT
  IPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMES
  GVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHN
  YYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQ
  FIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTK
  DVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSS
  EVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGP
  EYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVY
  QVPQSTQEVSGAGRDGECDVFKEIL

• Structural information:
  • Protein Domains: (72..18-)
    (/note="CUB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (187..28-)
    (/note="LCCL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00123-)
    (292..44-)
    C (/note="F5/8-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00081"-)
  • Interpro: IPR000859  IPR000421  IPR008979  IPR004043  IPR036609   IPR035914  
  • Prosite: PS01180 PS01285 PS50022 PS50820
  • CDD: cd00041 cd00057
  • STRING: ENSP00000321573
• Other Databases: GeneCards:  DCBLD2  Malacards:  DCBLD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0042060	wound healing	IDA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030522	intracellular receptor signaling pathway	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881