• Gene id: 131540

Gene Summary

• Gene Symbol: ZDHHC19   Gene   UCSC   Ensembl
• Aliases: DHHC19
• Gene name: zinc finger DHHC-type palmitoyltransferase 19
• Alternate names: palmitoyltransferase ZDHHC19, DHHC-19, probable palmitoyltransferase ZDHHC19, zinc finger DHHC domain-containing protein 19, zinc finger DHHC-type containing 19, zinc finger, DHHC domain containing 19,
• Gene location: 3q29 (196211436: 196197442)     Exons: 5     NC_000003.12
• OMIM: 618671

Protein Summary

• Protein general information: Q8WVZ1  
  • Name: Palmitoyltransferase ZDHHC19 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 19) (DHHC 19)
  • Length: 309  
  • Mass: 34352
• Sequence:

  MTLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCRWLAQNGEWAFPVITGSLFVLTFFS
  LVSLNFSDPGILHQGSAEQGPLTVHVVWVNHGAFRLQWCPKCCFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIG
  HRNFRFFMLLVLSLCLYSGAMLVTCLIFLVRTTHLPFSTDKAIAIVVAVSAAGLLVPLSLLLLIQALSVSSADRT
  YKGKCRHLQGYNPFDQGCASNWYLTICAPLGPKYMAEAVQLQRVVGPDWTSMPNLHPPMSPSALNPPAPTSGSLQ
  SREGTPGAW

• Structural information:
  • Protein Domains: (112..16-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000296326
• Other Databases: GeneCards:  ZDHHC19  Malacards:  ZDHHC19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IDA	molecular function
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IDA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IDA	biological process
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881