• Gene id: 131177

Gene Summary

• Gene Symbol: FAM3D   Gene   UCSC   Ensembl
• Aliases: EF7, OIT1
• Gene name: FAM3 metabolism regulating signaling molecule D
• Alternate names: protein FAM3D, Oncoprotein-induced transcript 1, cytokine-like protein EF-7, family with sequence similarity 3 member D,
• Gene location: 3p14.2 (58666842: 58633942)     Exons: 2     NC_000003.12
• OMIM: 608619

Protein Summary

• Protein general information: Q96BQ1  
  • Name: Protein FAM3D
  • Length: 224  
  • Mass: 24963
  • Tissue specificity: Abundantly expressed in placenta and weakly expressed in small intestine. {ECO
• Sequence:

  MRVSGVLRLLALIFAIVTTWMFIRSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAA
  NVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDP
  GTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF

• Structural information:
  • Interpro: IPR039220  IPR039240  IPR039477  IPR039475  
  • CDD: cd13940
  • STRING: ENSP00000351632
• Other Databases: GeneCards:  FAM3D  Malacards:  FAM3D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070093	negative regulation of glucagon secretion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0046676	negative regulation of insulin secretion	IDA	biological process
GO:0005576	extracellular region	NAS	cellular component
GO:0005125	cytokine activity	NAS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)