• Gene id: 130888

Gene Summary

• Gene Symbol: FBXO36   Gene   UCSC   Ensembl
• Aliases: Fbx36
• Gene name: F-box protein 36
• Alternate names: F-box only protein 36,
• Gene location: 2q36.3 (75569718: 75492317)     Exons: 7     NC_000002.12
• Gene summary(Entrez): Members of the F-box protein family, such as FBXO36, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box pr
• OMIM: 609105

Protein Summary

• Protein general information: Q8NEA4  
  • Name: F box only protein 36
  • Length: 188  
  • Mass: 22105
• Sequence:

  MASWLPETLFETVGQGPPPSKDYYQLLVTRSQVIFRWWKISLRSEYRSTKPGEAKETHEDFLENSHLQGQTALIF
  GARILDYVINLCKGKFDFLERLSDDLLLTIISYLDLEDIARLCQTSHRFAKLCMSDKLWEQIVQSTCDTITPDVR
  ALAEDTGWRQLFFTNKLQLQRQLRKRKQKYGNLREKQP

• Structural information:
  • Protein Domains: (91..13-)
    (/note="F-box-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00080"-)
  • Interpro: IPR036047  IPR001810  
  • Prosite: PS50181
  • STRING: ENSP00000283946
• Other Databases: GeneCards:  FBXO36  Malacards:  FBXO36

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray