• Gene id: 130733

Gene Summary

• Gene Symbol: TMEM178A   Gene   UCSC   Ensembl
• Aliases: TMEM178
• Gene name: transmembrane protein 178A
• Alternate names: transmembrane protein 178A, transmembrane protein 178,
• Gene location: 2p22.1 (39646747: 39736428)     Exons: 12     NC_000002.12

Protein Summary

• Protein general information: Q8NBL3  
  • Name: Transmembrane protein 178A
  • Length: 297  
  • Mass: 33019
• Sequence:

  MEPRALVTALSLGLSLCSLGLLVTAIFTDHWYETDPRRHKESCERSRAGADPPDQKNRLMPLSHLPLRDSPPLGR
  RLLPGGPGRADPESWRSLLGLGGLDAECGRPLFATYSGLWRKCYFLGIDRDIDTLILKGIAQRCTAIKYHFSQPI
  RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFWEESLTQHVAGLLFLMTGIFCTISL
  CTYAASISYDLNRLPKLIYSLPADVEHGYSWSIFCAWCSLGFIVAAGGLCIAYPFISRTKIAQLKSGRDSTV

• Structural information:
  • Interpro: IPR004031  IPR039625  
  • STRING: ENSP00000281961
• Other Databases: GeneCards:  TMEM178A  Malacards:  TMEM178A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0045671	negative regulation of osteoclast differentiation	IBA	biological process
GO:0051480	regulation of cytosolic calcium ion concentration	IBA	biological process
GO:0016020	membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0045671	negative regulation of osteoclast differentiation	ISS	biological process
GO:0051480	regulation of cytosolic calcium ion concentration	ISS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0051480	regulation of cytosolic calcium ion concentration	IEA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray