• Gene id: 130560

Gene Summary

• Gene Symbol: SPATA3   Gene   UCSC   Ensembl
• Aliases: TSARG1
• Gene name: spermatogenesis associated 3
• Alternate names: spermatogenesis-associated protein 3, testis and spermatogenesis cell apoptosis related gene 1, testis and spermatogenesis cell-related protein 1, testis spermatocyte apoptosis-related protein 1,
• Gene location: 2q37.1 (230996123: 231019937)     Exons: 3     NC_000002.12

Protein Summary

• Protein general information: Q8NHX4  
  • Name: Spermatogenesis associated protein 3 (Testis and spermatogenesis cell related protein 1) (Testis spermatocyte apoptosis related protein 1)
  • Length: 192  
  • Mass: 20901
• Sequence:

  MKKVKKKRSEARRHRDSTSQHASSNSTSQQPSPESTPQQPSPESTPQQPSPESTPQHSSLETTSRQPAFQALPAP
  EIRRSSCCLLSPDANVKAAPQSRKAGPLIRAGPHSCSCATCPCSSACWRRLGLCHSRIFDVLLPRDWQMAPGRGL
  PNLLTFYRKSSRKPSSHRNACPPSPRNCGCGSGGSRSCLLHH

• Structural information:
  • Interpro: IPR026717  
  • STRING: ENSP00000388895
• Other Databases: GeneCards:  SPATA3  Malacards:  SPATA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Role in male development, spermatogenesis or spermatogenesis cell apoptosis	MIK: 31006096
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
31006096	Role in male development, spermatogenesis or spermatogenesis cell apoptosis				Male infertility