• Gene id: 130367

Gene Summary

• Gene Symbol: SGPP2   Gene   UCSC   Ensembl
• Aliases: SPP2, SPPase2
• Gene name: sphingosine-1-phosphate phosphatase 2
• Alternate names: sphingosine-1-phosphate phosphatase 2, sphingosine 1-phosphate phosphohydrolase 2, sphingosine-1-phosphatase 2, sphingosine-1-phosphate phosphotase 2,
• Gene location: 2q36.1 (222423987: 222562620)     Exons: 7     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a transmembrane protein that degrades the bioactive signaling molecule sphingosine 1-phosphate. The encoded protein is induced during inflammatory responses and has been shown to be downregulated by the microRNA-31 tumo
• OMIM: 612827

Protein Summary

• Protein general information: Q8IWX5  
  • Name: Sphingosine 1 phosphate phosphatase 2 (SPPase2) (Spp2) (hSPP2) (EC 3.1.3. ) (Sphingosine 1 phosphatase 2)
  • Length: 399  
  • Mass: 44741
  • Tissue specificity: Expressed strongly in kidney and heart, followed by brain, colon, small intestine and lung. Not detected in skeletal muscle, thymus, spleen, liver, placenta, and peripheral blood leukocytes. {ECO
• Sequence:

  MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGEAPANGLRRAAAPEAY
  VQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRRLIIIWVLVMYIGQVAKDVLKWPRPSSPPVV
  KLEKRLIAEYGMPSTHAMAATAIAFTLLISTMDRYQYPFVLGLVMAVVFSTLVCLSRLYTGMHTVLDVLGGVLIT
  ALLIVLTYPAWTFIDCLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTILAAGAGVTIGFWINHFFQLV
  SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVLYSWFKVVTRNKEARRRLEIEVPYKF
  VTYTSVGICATTFVPMLHRFLGLP

• Structural information:
  • Interpro: IPR036938  IPR000326  
  • STRING: ENSP00000315137
• Other Databases: GeneCards:  SGPP2  Malacards:  SGPP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042577	lipid phosphatase activity	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0046839	phospholipid dephosphorylation	IBA	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0006670	sphingosine metabolic process	IBA	biological process
GO:0061469	regulation of type B pancreatic cell proliferation	ISS	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IMP	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030148	sphingolipid biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0061469	regulation of type B pancreatic cell proliferation	IEA	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006670	sphingosine metabolic process	IDA	biological process
GO:0042392	sphingosine-1-phosphate phosphatase activity	IDA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04071	Sphingolipid signaling pathway
hsa00600	Sphingolipid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881