• Gene id: 130106

Gene Summary

• Gene Symbol: CIB4   Gene   UCSC   Ensembl
• Aliases: KIP4
• Gene name: calcium and integrin binding family member 4
• Alternate names: calcium and integrin-binding family member 4,
• Gene location: 2p23.3 (26641797: 26581204)     Exons: 11     NC_000002.12
• OMIM: 120350

Protein Summary

• Protein general information: A0PJX0  
  • Name: Calcium and integrin binding family member 4
  • Length: 185  
  • Mass: 21745
• Sequence:

  MGQCLRYQMHWEDLEEYQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFS
  HKGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLNSDDMSEDLLMDLTNHVLSE
  SDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHFWGC

• Structural information:
  • Protein Domains: (62..9-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (97..13-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (138..17-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00-)
  • Interpro: IPR011992  IPR018247  IPR002048  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • STRING: ENSP00000288861
• Other Databases: GeneCards:  CIB4  Malacards:  CIB4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq