Search Result
| Gene id | 130074 | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | FAM168B Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||
| Aliases | MANI | ||||||||||||||||||||||||||||||||||||||||
| Gene name | family with sequence similarity 168 member B | ||||||||||||||||||||||||||||||||||||||||
| Alternate names | myelin-associated neurite-outgrowth inhibitor, protein FAM168B, | ||||||||||||||||||||||||||||||||||||||||
| Gene location |
2q21.1 (131093467: 131047875) Exons: 12 NC_000002.12 |
||||||||||||||||||||||||||||||||||||||||
| OMIM | 0 | ||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||
| Protein general information | A1KXE4 Name: Myelin associated neurite outgrowth inhibitor (Mani) (p20) Length: 195 Mass: 20324 Tissue specificity: Expressed in the brain, within neuronal axonal fibers and associated with myelin sheets (at protein level). Expression tends to be lower in the brain of Alzheimer disease patients compared to healthy individuals (at protein level). {EC | ||||||||||||||||||||||||||||||||||||||||
| Sequence |
MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSS SPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPIPPPRGNGVTMGMVA GTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW | ||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: FAM168B  Malacards: FAM168B | ||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||