• Gene id: 130

Gene Summary

• Gene Symbol: ADH6   Gene   UCSC   Ensembl
• Aliases: ADH-5
• Gene name: alcohol dehydrogenase 6 (class V)
• Alternate names: alcohol dehydrogenase 6, aldehyde reductase,
• Gene location: 4q23 (99219245: 99202638)     Exons: 9     NC_000004.12
• Gene summary(Entrez): This gene encodes class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxi
• OMIM: 103735

Protein Summary

• Protein general information: P28332  
  • Name: Alcohol dehydrogenase 6 (EC 1.1.1.1)
  • Length: 368  
  • Mass: 39073
  • Tissue specificity: Stomach and liver.
• Sequence:

  MSTTGQVIRCKAAILWKPGAPFSIEEVEVAPPKAKEVRIKVVATGLCGTEMKVLGSKHLDLLYPTILGHEGAGIV
  ESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYHFGNTSTFCEY
  TVIKEISVAKIDAVAPLEKVCLISCGFSTGFGAAINTAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIGVDV
  NKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGIDFCFEAIGNLDVLAAALASCNESYGVCVVVGVLPASV
  QLKISGQLFFSGRSLKGSVFGGWKSRQHIPKLVADYMAEKLNLDPLITHTLNLDKINEAVELMKTGKW

• Structural information:
  • Interpro: IPR013149  IPR013154  IPR002328  IPR011032  IPR036291   IPR020843  
  • Prosite: PS00059
  • STRING: ENSP00000378359
• Other Databases: GeneCards:  ADH6  Malacards:  ADH6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004745	retinol dehydrogenase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0008270	zinc ion binding	IBA	molecular function
GO:0042572	retinol metabolic process	IBA	biological process
GO:0042573	retinoic acid metabolic process	IBA	biological process
GO:0004024	alcohol dehydrogenase activity, zinc-dependent	IBA	molecular function
GO:0006069	ethanol oxidation	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004022	alcohol dehydrogenase (NAD+) activity	IEA	molecular function
GO:0006069	ethanol oxidation	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006069	ethanol oxidation	IDA	biological process
GO:0045471	response to ethanol	IDA	biological process
GO:0004022	alcohol dehydrogenase (NAD+) activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008270	zinc ion binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00010	Glycolysis / Gluconeogenesis
hsa00071	Fatty acid degradation
hsa00350	Tyrosine metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)