• Gene id: 129138

Gene Summary

• Gene Symbol: ANKRD54   Gene   UCSC   Ensembl
• Aliases: LIAR
• Gene name: ankyrin repeat domain 54
• Alternate names: ankyrin repeat domain-containing protein 54, lyn-interacting ankyrin repeat protein,
• Gene location: 22q13.1 (37849317: 37830852)     Exons: 9     NC_000022.11
• OMIM: 601167

Protein Summary

• Protein general information: Q6NXT1  
  • Name: Ankyrin repeat domain containing protein 54 (Lyn interacting ankyrin repeat protein)
  • Length: 300  
  • Mass: 32505
• Sequence:

  MAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQD
  AEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFA
  SCNGNDQIVQLLLDHGADPNQRDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQE
  GHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR

• Structural information:
  • Interpro: IPR002110  IPR020683  IPR036770  
  • Prosite: PS50297 PS50088
  • STRING: ENSP00000215941
• Other Databases: GeneCards:  ANKRD54  Malacards:  ANKRD54

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019887	protein kinase regulator activity	IBA	molecular function
GO:1902531	regulation of intracellular signal transduction	IBA	biological process
GO:0045859	regulation of protein kinase activity	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902531	regulation of intracellular signal transduction	IEA	biological process
GO:0045859	regulation of protein kinase activity	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0030496	midbody	IEA	cellular component
GO:0006913	nucleocytoplasmic transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045648	positive regulation of erythrocyte differentiation	IEA	biological process
GO:0019887	protein kinase regulator activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045648	positive regulation of erythrocyte differentiation	ISS	biological process
GO:1902531	regulation of intracellular signal transduction	ISS	biological process
GO:0030496	midbody	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881