• Gene id: 129025

Gene Summary

• Gene Symbol: ZNF280A   Gene   UCSC   Ensembl
• Aliases: 3'OY11.1, SUHW1, ZNF280, ZNF636
• Gene name: zinc finger protein 280A
• Alternate names: zinc finger protein 280A, suppressor of hairy wing homolog 1, zinc finger protein 280, zinc finger protein 636,
• Gene location: 22q11.22 (22520269: 22513735)     Exons: 2     NC_000022.11
• Gene summary(Entrez): This gene encodes a zinc finger protein. The encoded protein contains 4 C2H2-type zinc fingers, which are commonly found in transcription factors. A variety of functions may be performed by this type of zinc finger protein, including the binding of DNA or
• OMIM: 617530

Protein Summary

• Protein general information: P59817  
  • Name: Zinc finger protein 280A (3'OY11.1) (Suppressor of hairy wing homolog 1) (Zinc finger protein 636)
  • Length: 542  
  • Mass: 60816
• Sequence:

  MGDIFLCKKVESPKKNLRESKQREEDDEDPDLIYVGVEHVHRDAEVLFVGMISNSKPVVSNILNRVTPGSKSRRK
  KGHFRQYPAHVSQPANHVTSMAKAIMPVSLSEGRSTDSPVTMKSSSEPGYKMSSPQVVSPNYSDSLPPGTQCLVG
  AMVSGGGRNESSPDSKRLSTSDINSRDSKRVKLRDGIPGVPSLAVVPSDMSSTISTNTPSQGICNSSNHVQNGVT
  FPWPDANGKAHFNLTDPERANESGLAMTDISSLASQNKTFDPKKENPIVLLSNFYYGQHKGDGQPEQKTHTTFKC
  LSCVKVLKNIKFMNHMKHHLEFEKQRNDSWEDHTTCQHCHRQFPTPFQLQCHIDSVHIAMGPSAVCKICELSFET
  DQVLLQHMKDHHKPGEMPYVCQVCHYRSSVFADVETHFRTCHENTKNLLCLFCLKLFKTAIPYMNHCWRHSRRRV
  LQCSKCRLQFLTLKEEIEHKTKDHQTFKKPEQLQGFPRETKVIIQTSVQPGSSGMASVIVSNTDPQSSPVKTKKK
  TAMNTRDSRLPCSKDSS

• Structural information:
  • Interpro: IPR025243  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000302855
• Other Databases: GeneCards:  ZNF280A  Malacards:  ZNF280A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881