Search Result
| Gene id | 128989 | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||
| Gene Symbol | TANGO2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||
| Aliases | C22orf25, MECRCN | ||||||||||||||||||||||||||||
| Gene name | transport and golgi organization 2 homolog | ||||||||||||||||||||||||||||
| Alternate names | transport and Golgi organization protein 2 homolog, | ||||||||||||||||||||||||||||
| Gene location |
22q11.21 (20016999: 20067163) Exons: 12 NC_000022.11 |
||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene belongs to the transport and Golgi organization family, whose members are predicted to play roles in secretory protein loading in the endoplasmic reticulum. Depletion of this gene in Drosophila S2 cells causes fusion of the Golgi with the ER. In |
||||||||||||||||||||||||||||
| OMIM | 614912 | ||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||
| Protein general information | Q6ICL3 Name: Transport and Golgi organization protein 2 homolog Length: 276 Mass: 30937 | ||||||||||||||||||||||||||||
| Sequence |
MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGLDMEEGKEGGTWLGISTRGKLAALTN YLQPQLDWQARGRGELVTHFLTTDVDSLSYLKKVSMEGHLYNGFNLIAADLSTAKGDVICYYGNRGEPDPIVLTP GTYGLSNALLETPWRKLCFGKQLFLEAVERSQALPKDVLIASLLDVLNNEEAQLPDPAIEDQGGEYVQPMLSKYA AVCVRCPGYGTRTNTIILVDADGHVTFTERSMMDKDLSHWETRTYEFTLQS | ||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||
| Other Databases | GeneCards: TANGO2  Malacards: TANGO2 | ||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||