• Gene id: 128861

Gene Summary

• Gene Symbol: BPIFA3   Gene   UCSC   Ensembl
• Aliases: C20orf71, SPLUNC3
• Gene name: BPI fold containing family A member 3
• Alternate names: BPI fold-containing family A member 3, short long palate, lung and nasal epithelium carcinoma associated 3,
• Gene location: 20q11.21 (33217309: 33227805)     Exons: 10     NC_000020.11

Protein Summary

• Protein general information: Q9BQP9  
  • Name: BPI fold containing family A member 3 (Short palate, lung and nasal epithelium carcinoma associated protein 3)
  • Length: 254  
  • Mass: 28436
• Sequence:

  MMCPLWRLLIFLGLLALPLAPHKQPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPG
  LVGWLISGRKHQQQQESSINITNIQLDCGGIQISFHKEWFSANISLEFDLELRPSFDNNIVKMCAHMSIVVEFWL
  EKDEFGRRDLVIGKCDAEPSSVHVAILTEAIPPKMNQFLYNLKENLQKVLPHMVESQVCPLIGEILGQLDVKLLK
  SLIEQEAAHEPTHHETSQPSACQAGESPS

• Structural information:
  • Interpro: IPR017943  IPR032946  IPR017942  
  • STRING: ENSP00000364603
• Other Databases: GeneCards:  BPIFA3  Malacards:  BPIFA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008289	lipid binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)