• Gene id: 128674

Gene Summary

• Gene Symbol: PROKR2   Gene   UCSC   Ensembl
• Aliases: GPR73L1, GPR73b, GPRg2, HH3, KAL3, PKR2, dJ680N4.3
• Gene name: prokineticin receptor 2
• Alternate names: prokineticin receptor 2, G protein-coupled receptor 73-like 1, G-protein coupled receptor I5E, PK-R2,
• Gene location: 20p12.3 (5316731: 5298851)     Exons: 4     NC_000020.11
• Gene summary(Entrez): Prokineticins are secreted proteins that can promote angiogenesis and induce strong gastrointestinal smooth muscle contraction. The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor for prokineticins. The encoded
• OMIM: 607123

Protein Summary

• Protein general information: Q8NFJ6  
  • Name: Prokineticin receptor 2 (PK R2) (G protein coupled receptor 73 like 1) (G protein coupled receptor I5E) (GPR73b) (GPRg2)
  • Length: 384  
  • Mass: 43,996
• Sequence:

  MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIALAGIMLVCGIGNFVFI
  AALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALLAIA
  IDRYLAIVHPLKPRMNYQTASFLIALVWMVSILIAIPSAYFATETVLFIVKSQEKIFCGQIWPVDQQLYYKSYFL
  FIFGVEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPFYGFTIVRDF
  FPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLLHWRPSQRGSKSSADLDLRTNGVPTT
  EEVDCIRLK

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR000611  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000217270
• Other Databases: GeneCards:  PROKR2  Malacards:  PROKR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G-protein coupled receptor activity	IBA	molecular function
GO:0004983	neuropeptide Y receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007623	circadian rhythm	IBA	biological process
GO:0004871	signal transducer activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004930	G-protein coupled receptor activity	IBA	molecular function
GO:0004930	G-protein coupled receptor activity	IEA	molecular function
GO:0004983	neuropeptide Y receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IEA	biological process
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0007623	circadian rhythm	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G-protein coupled receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0007186	G-protein coupled receptor signaling pathway	IBA	biological process
GO:0007623	circadian rhythm	IBA	biological process

Diseases

Associated diseases	References
Obesity	GAD: 20734064
Hypogonadotropic hypogonadism	KEGG: H00255
Kallmann syndrome (KS)	MIK: 24031091
Amenorrhoea	GAD: 21247312
Abortion	GAD: 20847187
Hypogonadism	MIK: 24276467
Kallmann syndrome	MIK: 24031091
Hypospadias	MIK: 31219235
Kallmann syndrome	MIK: 18723471
Hypogonadotropic hypogonadism	MIK: 26031747

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
24276467	Hypogonadism	p.V158I, p.V334M, p.L173R, p.T260M, p.R268C, p.V274D, p.V331M, p.H20MfsX23 and p.N15TfsX30		246 hypogonadism	Male infertility, Female infertility
26031747	Kallmann syndrome, idiopathic hypogonadotropic hypogonadism (idiopathic hypogonadotropic hypogonadism)	KAL1 p.R191ter (pedigree 1); homozygous KAL1 p.C13ter (pedigree 2; a novel mutation); heterozygous FGFR1p.R250W (pedigree 3); and homozygous PROKR2 p.Y113H	Chinese	270 (70 sporadic Kallmann syndrome cases, 200 Chinese healthy controls)	Male infertility, Female infertility
24031091	Hypogonadotropic hypogonadism, Kallmann syndrome		Maghreb ian, Eu ropean patient s	832 (120 presumably unrelated Maghrebian patients, 712 European patients)	Male infertility, Female infertility	KAL1  FGFR1 FGF8 PROKR2 and PROK2
18723471	Kallmann syndrome	T-to-G transversion in exon 2 (c.518T>G) of the PROKR2		24 Kallmann syndrome	Male infertility, Female infertility	FGFR1 PROKR2 KAL PROK2
31219235	Hypospadias	c.G533C(p.W178S),c.G533C(p.W178S)	Chinese	131 cases	Male infertility	NGS