• Gene id: 128497

Gene Summary

• Gene Symbol: SPATA25   Gene   UCSC   Ensembl
• Aliases: C20orf165, TSG23, dJ337O18.8
• Gene name: spermatogenesis associated 25
• Alternate names: spermatogenesis-associated protein 25, testis-specific gene 23 protein,
• Gene location: 20q13.12 (45890814: 45886490)     Exons: 3     NC_000020.11
• OMIM: 0

Protein Summary

• Protein general information: Q9BR10  
  • Name: Spermatogenesis associated protein 25 (Testis specific gene 23 protein)
  • Length: 227  
  • Mass: 23,834
• Sequence:

  MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQAWGPALAMPQARGCPG
  GTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPSRPRPLMLCGLSPRVLPVPSEAVGKEASSQP
  DICILTLAMMIAGIPTVPVPGVREEDLIWAAQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGS
  CL

• Structural information:
  • Interpro: IPR029192  
  • STRING: ENSP00000361597
• Other Databases: GeneCards:  SPATA25  Malacards:  SPATA25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0007283	spermatogenesis	IEP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007283	spermatogenesis	IEP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0007283	spermatogenesis	IEP	biological process

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 19240080
Non-obstructive azoospermia	MIK: 19240080

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19240080	Non-obstructive azoospermia				Male infertility	TSG23