|
Gene id |
128312 |
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
H2BU1 Gene UCSC Ensembl |
|
Aliases |
H2Bb, HIST3H2BB |
|
Gene name |
H2B.U histone 1 |
|
Alternate names |
histone H2B type 3-B, H2B type 12, histone 3, H2bb, histone cluster 3 H2B family member b, histone cluster 3, H2bb, |
|
Gene location |
1q42.13 (228458102: 228458557) Exons: 1 NC_000001.11
|
|
Gene summary(Entrez) |
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi
|
|
OMIM |
602950 |
Protein Summary
|
| Protein general information
| Q8N257
Name: Histone H2B type 3 B (H2B type 12) (H2B.U histone 1)
Length: 126 Mass: 13908
|
| Sequence |
MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIA SEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
|
| Structural information |
|
| Other Databases |
GeneCards: H2BU1  Malacards: H2BU1 |
|
|
|
|
|
|
|
| Associated diseases |
References |
| Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
|