• Gene id: 127700

Gene Summary

• Gene Symbol: OSCP1   Gene   UCSC   Ensembl
• Aliases: C1orf102, NOR1
• Gene name: organic solute carrier partner 1
• Alternate names: protein OSCP1, organic solute carrier protein 1, organic solute transport protein 1, oxidored nitro domain containing protein, oxidored-nitro domain-containing protein 1,
• Gene location: 1p34.3 (70523553: 70480566)     Exons: 20     NC_000016.10
• OMIM: 608854

Protein Summary

• Protein general information: Q8WVF1  
  • Name: Protein OSCP1 (hOSCP1) (Organic solute transport protein 1) (Oxidored nitro domain containing protein 1)
  • Length: 389  
  • Mass: 44586
  • Tissue specificity: Expressed predominantly in testis, also found in placenta and to a lesser extent in thymus and small intestine; abundantly expressed in tumor-derived cell lines (PubMed
• Sequence:

  MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLNDIISTMFNRKFMEELFKPQELYSKK
  ALRTVYERLAHASIMKLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDTIKGFIRDSPTILQQVDETL
  RQLTEIYGGLSAGEFQLIRQTLLIFFQDLHIRVSMFLKDKVQNNNGRFVLPVSGPVPWGTEVPGLIRMFNNKGEE
  VKRIEFKHGGNYVPAPKEGSFELYGDRVLKLGTNMYSVNQPVETHVSGSSKNLASWTQESIAPNPLAKEELNFLA
  RLMGGMEIKKPSGPEPGFRLNLFTTDEEEEQAALTRPEELSYEVINIQATQDQQRSEELARIMGEFEITEQPRLS
  TSKGDDLLAMMDEL

• Structural information:
  • Interpro: IPR019332  
  • STRING: ENSP00000235532
• Other Databases: GeneCards:  OSCP1  Malacards:  OSCP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0009925	basal plasma membrane	IEA	cellular component
GO:0009925	basal plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1990961	xenobiotic detoxification by transmembrane export across the plasma membrane	IMP	biological process
GO:0022857	transmembrane transporter activity	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R