Male Infertility Database

Search Result

Gene id

127495

Gene Summary Protein Summary Gene ontology Diseases PubMed

Gene Summary

Gene Symbol

LRRC39 Gene UCSC Ensembl

Gene name

leucine rich repeat containing 39

Alternate names

leucine-rich repeat-containing protein 39, densin hlg, myomasp, myosin-interacting M-band-associated stress-responsive protein,

Gene location

1p21.2 (10011247: 9962679) Exons: 11 NC_000003.12

Protein Summary

Protein general information

Q96DD0

Name: Leucine rich repeat containing protein 39 (Myosin interacting M band associated stress responsive protein) (Myomasp)

Length: 335 Mass: 38793

Tissue specificity: Highly expressed in skeletal muscle and heart. Not detected in other tissues tested. {ECO

Sequence

MTENVVCTGAVNAVKEVWEKRIKKLNEDLKREKEFQHKLVRIWEERVSLTKLREKVTREDGRVILKIEKEEWKTL
PSSLLKLNQLQEWQLHRTGLLKIPEFIGRFQNLIVLDLSRNTISEIPPGIGLLTRLQELILSYNKIKTVPKELSN
CASLEKLELAVNRDICDLPQELSNLLKLTHLDLSMNDFTTIPLAVLNMPALEWLDMGSNKLEQLPDTIERMQNLH
TLWLQRNEITCLPQTISNMKNLGTLVLSNNKLQDIPVCMEEMANLRFVNFRDNPLKLKVSLPPSEGTDEEEEREL
FGLQFMHTYIQESRRRADHQVNGSTTLPISINTDG

Structural information

Interpro:	IPR001611 IPR025875 IPR003591 IPR032675
Prosite:	PS51450
STRING:	ENSP00000480740

Other Databases

GeneCards: LRRC39 Malacards: LRRC39

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0031430	M band	IEA	cellular component

Diseases

Expand All | Collapse All

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

Expand All | Collapse All

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17327269	Teratozoos permia	13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
17327269	Teratozoos permia	19 (6 controls , 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
28606200	Cryptorchi dism	Monozgotic twin s (1 control, I cwith cryptorc hidism)	Male infertility	MeDIP-Seq	Show abstract
28361989	Hyposperma togenesis	6 (3 controls, 3 Klienfelter s yndrome	Male infertility	Microarray	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Diseases

Expand All | Collapse All