• Gene id: 127428

Gene Summary

• Gene Symbol: TCEANC2   Gene   UCSC   Ensembl
• Aliases: C1orf83
• Gene name: transcription elongation factor A N-terminal and central domain containing 2
• Alternate names: transcription elongation factor A N-terminal and central domain-containing protein 2, transcription elongation factor A (SII) N-terminal and central domain containing 2,
• Gene location: 1p32.3 (54053607: 54112519)     Exons: 6     NC_000001.11
• OMIM: 615334

Protein Summary

• Protein general information: Q96MN5  
  • Name: Transcription elongation factor A N terminal and central domain containing protein 2
  • Length: 208  
  • Mass: 24150
• Sequence:

  MDKFVIRTPRIQNSPQKKDSGGKVYKQATIESLKRVVVVEDIKRWKTMLELPDQTKENLVEALQELKKKIPSREV
  LKSTRIGHTVNKMRKHSDSEVASLAREVYTEWKTFTEKHSNRPSIEVRSDPKTESLRKNAQKLLSEALELKMDHL
  LVENIERETFHLCSRLINGPYRRTVRALVFTLKHRAEIRAQVKSGSLPVGTFVQTHKK

• Structural information:
  • Protein Domains: (40..11-)
    (/note="TFIIS-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00649-)
    (131..20-)
    (/note="TFIIS-central)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00651"-)
  • Interpro: IPR003617  IPR035441  IPR003618  IPR036575  IPR017923  
  • Prosite: PS51321 PS51319
  • STRING: ENSP00000234827
• Other Databases: GeneCards:  TCEANC2  Malacards:  TCEANC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray