• Gene id: 127253

Gene Summary

• Gene Symbol: TYW3   Gene   UCSC   Ensembl
• Aliases: C1orf171
• Gene name: tRNA-yW synthesizing protein 3 homolog
• Alternate names: tRNA wybutosine-synthesizing protein 3 homolog, tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase, tRNA-yW-synthesizing protein 3,
• Gene location: 1p31.1 (74733151: 74766676)     Exons: 6     NC_000001.11
• Gene summary(Entrez): Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW3 is the human homolog of a yeast gene essential for yW s
• OMIM: 611245

Protein Summary

• Protein general information: Q6IPR3  
  • Name: tRNA wybutosine synthesizing protein 3 homolog (tRNA yW synthesizing protein 3) (EC 2.1.1.282) (tRNA(Phe) 7 ((3 amino 3 carboxypropyl) 4 demethylwyosine(37) N(4)) methyltransferase)
  • Length: 259  
  • Mass: 29794
• Sequence:

  MDRSAEFRKWKAQCLSKADLSRKGSVDEDVVELVQFLNMRDQFFTTSSCAGRILLLDRGINGFEVQKQNCCWLLV
  THKLCVKDDVIVALKKANGDATLKFEPFVLHVQCRQLQDAQILHSMAIDSGFRNSGITVGKRGKTMLAVRSTHGL
  EVPLSHKGKLMVTEEYIDFLLNVANQKMEENKKRIERFYNCLQHALERETMTNLHPKIKEKNNSSYIHKKKRNPE
  KTRAQCITKESDEELENDDDDDLGINVTIFPEDY

• Structural information:
  • Interpro: IPR003827  IPR036602  
  • STRING: ENSP00000359904
• Other Databases: GeneCards:  TYW3  Malacards:  TYW3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0008175	tRNA methyltransferase activity	IBA	molecular function
GO:0031591	wybutosine biosynthetic process	IBA	biological process
GO:0030488	tRNA methylation	IBA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008033	tRNA processing	IEA	biological process
GO:0032259	methylation	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)