• Gene id: 127247

Gene Summary

• Gene Symbol: ASB17   Gene   UCSC   Ensembl
• Aliases: Asb-17
• Gene name: ankyrin repeat and SOCS box containing 17
• Alternate names: ankyrin repeat and SOCS box protein 17,
• Gene location: 1p31.1 (75937624: 75918872)     Exons: 4     NC_000001.11

Protein Summary

• Protein general information: Q8WXJ9  
  • Name: Ankyrin repeat and SOCS box protein 17 (ASB 17)
  • Length: 295  
  • Mass: 34282
  • Tissue specificity: Specifically expressed in testis. Not detected in other tissues tested. {ECO
• Sequence:

  MSKSTKLCGKTSCPRSNIFCNLLDKIVKRPSLQFLGQWGYHCYEPRIYRSLAKILRYVDLDGFDALLTDYIAFVE
  KSGYRFEVSFNLDFTEICVNTILYWVFARKGNPDFVELLLKKTKDYVQDRSCNLALIWRTFTPVYCPSPLSGITP
  LFYVAQTRQSNIFKILLQYGILEREKNPINIVLTIVLYPSRVRVMVDRELADIHEDAKTCLVLCSRVLSVISVKE
  IKTQLSLGRHPIISNWFDYIPSTRYKDPCELLHLCRLTIRNQLLTNNMLPDGIFSLLIPARLQNYLNLEI

• Structural information:
  • Protein Domains: (232..29-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR036770  IPR039147  IPR001496  IPR036036  
  • Prosite: PS50225
  • STRING: ENSP00000284142
• Other Databases: GeneCards:  ASB17  Malacards:  ASB17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Non obstructive azoospermia	MIK: 24012201
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)