• Gene id: 125228

Gene Summary

• Gene Symbol: FAM210A   Gene   UCSC   Ensembl
• Aliases: C18orf19, HsT2329
• Gene name: family with sequence similarity 210 member A
• Alternate names: protein FAM210A, uncharacterized protein C18orf19,
• Gene location: 18p11.21 (13726557: 13663346)     Exons: 6     NC_000018.10
• OMIM: 617975

Protein Summary

• Protein general information: Q96ND0  
  • Name: Protein FAM210A
  • Length: 272  
  • Mass: 30777
• Sequence:

  MQWNVPRTVSRLARRTCLEPHNAGLFGHCQNVKGPLLLYNAESKVVLVQGPQKQWLHLSAAQCVAKERRPLDAHP
  PQPGVLRHKQGKQHVSFRRVFSSSATAQGTPEKKEEPDPLQDKSISLYQRFKKTFRQYGKVLIPVHLITSGVWFG
  TFYYAALKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTP
  PPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKEKVSFKKKVE

• Structural information:
  • Protein Domains: (117..22-)
    (/note="DUF1279"-)
  • Interpro: IPR009688  
  • STRING: ENSP00000323635
• Other Databases: GeneCards:  FAM210A  Malacards:  FAM210A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881