• Gene id: 124641

Gene Summary

• Gene Symbol: OVCA2   Gene   UCSC   Ensembl
• Gene name: OVCA2 serine hydrolase domain containing
• Alternate names: esterase OVCA2, candidate tumor suppressor in ovarian cancer 2, ovarian cancer gene-2 protein, ovarian cancer-associated gene 2 protein, ovarian tumor suppressor candidate 2,
• Gene location: 17p13.3 (2042021: 2043424)     Exons: 2     NC_000017.11
• OMIM: 607896

Protein Summary

• Protein general information: Q8WZ82  
  • Name: Esterase OVCA2 (EC 3.1.2. ) (Ovarian cancer associated gene 2 protein)
  • Length: 227  
  • Mass: 24418
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWF
  SEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSG
  FCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQF
  AE

• Structural information:
  • Interpro: IPR029058  IPR005645  
  • STRING: ENSP00000461388
• Other Databases: GeneCards:  OVCA2  Malacards:  OVCA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0032526	response to retinoic acid	IBA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0032526	response to retinoic acid	IDA	biological process
GO:0016787	hydrolase activity	NAS	molecular function

Diseases

Associated diseases	References
Ovarian cancer	PMID:8616839
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881