• Gene id: 124446

Gene Summary

• Gene Symbol: TMEM219   Gene   UCSC   Ensembl
• Aliases: IGFBP-3R
• Gene name: transmembrane protein 219
• Alternate names: insulin-like growth factor-binding protein 3 receptor, testicular tissue protein Li 203,
• Gene location: 16p11.2 (29962078: 29973047)     Exons: 7     NC_000016.10

Protein Summary

• Protein general information: Q86XT9  
  • Name: Insulin like growth factor binding protein 3 receptor (IGFBP 3R) (Transmembrane protein 219)
  • Length: 240  
  • Mass: 25724
  • Tissue specificity: Widely expressed in normal tissues but suppressed in prostate and breast tumor. {ECO
• Sequence:

  MGNCQAGHNLHLCLAHHPPLVCATLILLLLGLSGLGLGSFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGT
  VTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGI
  LPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSRLLVLGSFLLLFCGLLCCVTAM
  CFHPRRESHWSRTRL

• Structural information:
  • Interpro: IPR039493  IPR039587  
  • STRING: ENSP00000457492
• Other Databases: GeneCards:  TMEM219  Malacards:  TMEM219

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray