Search Result
| Gene id | 123228 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | SENP8 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | DEN1, NEDP1, PRSC2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | SUMO peptidase family member, NEDD8 specific | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | sentrin-specific protease 8, NEDD8 specific-protease cysteine 2, NEDD8-specific protease 1, SUMO sentrin specific protease family member 8, SUMO/sentrin peptidase family member, NEDD8 specific, SUMO/sentrin specific peptidase family member 8, deneddylase 1, prot, | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
15q23 (72114257: 72143691) Exons: 5 NC_000015.10 |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregul |
||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 608659 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q96LD8 Name: Sentrin specific protease 8 (EC 3.4.22. ) (Deneddylase 1) (NEDD8 specific protease 1) (Protease, cysteine 2) (Sentrin/SUMO specific protease SENP8) Length: 212 Mass: 24107 Tissue specificity: Broadly expressed, with highest levels in kidney and pancreas. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFL EPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFV EEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: SENP8  Malacards: SENP8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||