• Gene id: 122616

Gene Summary

• Gene Symbol: CLBA1   Gene   UCSC   Ensembl
• Aliases: C14orf79
• Gene name: clathrin binding box of aftiphilin containing 1
• Alternate names: uncharacterized protein CLBA1, clathrin-binding box of aftiphilin-containing protein 1, uncharacterized protein C14orf79,
• Gene location: 14q32.33 (104985787: 105000309)     Exons: 7     NC_000014.9

Protein Summary

• Protein general information: Q96F83  
  • Name: Uncharacterized protein CLBA1 (Clathrin binding box of aftiphilin containing protein 1)
  • Length: 325  
  • Mass: 35690
• Sequence:

  MQGRRELGGEPLSDLQEEAASASLRVAPERLSDDSLEWRRTCPDLLLSDGKASISMPREGGSTCTARCPDPGEHS
  STWGEFEGFRESSAKSGQFSQSLELLEGPTEPQPPRTTSAPKECSSHQPCQGGPWVTGTSAVPPSEPILSYENIL
  KCAFQEITVQQAAEDVSTIDHFLEISSEEKPGVERVHKLCNESRKLWRALQSIHTTSTSQRLWSESRCQENFFLV
  LGIDAAQKNLSGGQGHIMEDCDLKEPEGLLTVSSFCLQHCKALIQTKLSGPPGSKQGRLMTCSRFLKTPSCGGGQ
  HITIPRKRMFTPRKLKLTLFNSDVC

• Structural information:
  • Interpro: IPR029205  
  • STRING: ENSP00000450114
• Other Databases: GeneCards:  CLBA1  Malacards:  CLBA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046907	intracellular transport	IBA	biological process
GO:0032588	trans-Golgi network membrane	IBA	cellular component
GO:0030276	clathrin binding	IBA	molecular function
GO:0030121	AP-1 adaptor complex	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray