Search Result
| Gene id | 120376 | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||
| Gene Symbol | COLCA2 Gene UCSC Ensembl | ||||||||||||||||||||
| Aliases | C11orf93, CASC13, LOH11CR1G | ||||||||||||||||||||
| Gene name | colorectal cancer associated 2 | ||||||||||||||||||||
| Alternate names | colorectal cancer-associated protein 2, cancer susceptibility candidate 13, cancer susceptibility candidate protein 13, colorectal cancer associated two, | ||||||||||||||||||||
| Gene location |
11q23.1 (111298348: 111308734) Exons: 10 NC_000011.10 |
||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||
| Protein general information | A8K830 Name: Colorectal cancer associated protein 2 (Cancer susceptibility candidate protein 13) Length: 154 Mass: 16850 Tissue specificity: Expressed in many cell types of epithelial, mesenchymal and hematopoietic origins. {ECO | ||||||||||||||||||||
| Sequence |
MHPEPLLNSTQSAPHHFPDSFQATPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYAPENYNSPASLDTRTC GYPPEDHSYQHLSSHAQYSCFSSATTSICYCASCEAEDLDALQAAEYFYPSTDCVDFAPSAAATSDFYKRETNCD ICYS | ||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||
| Other Databases | GeneCards: COLCA2  Malacards: COLCA2 | ||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||
| |||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||
| |||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||
| |||||||||||||||||||||