|
Gene id |
119180 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
LYZL2 Gene UCSC Ensembl |
|
Aliases |
LYZD2 |
|
Gene name |
lysozyme like 2 |
|
Alternate names |
lysozyme-like protein 2, lysozyme D2, lysozyme-2, |
|
Gene location |
10p11.23 (30629760: 30606221) Exons: 35 NC_000010.11
|
|
Gene summary(Entrez) |
Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL2 is a member of a family of lysozyme-like genes (Zhang
|
|
OMIM |
612748 |
Protein Summary
|
| Protein general information
| Q7Z4W2
Name: Lysozyme like protein 2 (Lysozyme 2) (EC 3.2.1.17)
Length: 148 Mass: 16656
Tissue specificity: Expressed in testis, epididymis and placenta. {ECO
|
| Sequence |
MKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIF QINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS
|
| Structural information |
|
| Other Databases |
GeneCards: LYZL2  Malacards: LYZL2 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0050830 |
defense response to Gram- positive bacterium
|
IBA |
biological process |
GO:0050829 |
defense response to Gram- negative bacterium
|
IBA |
biological process |
GO:0003796 |
lysozyme activity
|
IEA |
molecular function |
GO:0008152 |
metabolic process
|
IEA |
biological process |
GO:0016787 |
hydrolase activity
|
IEA |
molecular function |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0016798 |
hydrolase activity, actin g on glycosyl bonds
|
IEA |
molecular function |
GO:0003796 |
lysozyme activity
|
IEA |
molecular function |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
|
|
| Associated diseases |
References |
| Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
| Non obstructive azoospermia | MIK: 24012201 |
| Sertoli cell only syndrome | MIK: 23869807 |
| Teratozoospermia | MIK: 17327269 |
| Spermatogenic defects | MIK: 31037746 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 24012201 |
Non obstru ctive azoo spermia
|
|
|
31 (4 controls, 27 cases)
|
Male infertility |
GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 23869807 |
Non obstru ctive azoo spermia, S ertoli cel l only syn drome
|
|
|
20 (4 controls, 16 cases)
|
Male infertility |
GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
| 31037746 |
Spermatoge nic defect s
|
|
|
16 (1 control, 15 cases)
|
Male infertility |
GSE6023 analyzed using GEO2R
|
Show abstract |
|