• Gene id: 117194

Gene Summary

• Gene Symbol: MRGPRX2   Gene   UCSC   Ensembl
• Aliases: MGRG3, MRGX2
• Gene name: MAS related GPR family member X2
• Alternate names: mas-related G-protein coupled receptor member X2, G protein-coupled receptor MRGX2, MAS-related GPR, member X2, Mas-related G protein-coupled receptor G3,
• Gene location: 11p15.1 (19060716: 19054454)     Exons: 3     NC_000011.10
• OMIM: 607228

Protein Summary

• Protein general information: Q96LB1  
  • Name: Mas related G protein coupled receptor member X2
  • Length: 330  
  • Mass: 37099
  • Tissue specificity: Mainly expressed in mast cells. Has a limited expression profile, both peripheral and within the central nervous system, with highest levels in dorsal root ganglion (PubMed
• Sequence:

  MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGAD
  FLFLCFQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCRRPRHLSAVVC
  VLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTI
  LLTVLVFLLCGLPFGIQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLAL
  QRALQDIAEVDHSEGCFRQGTPEMSRSSLV

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR026234  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000333800
• Other Databases: GeneCards:  MRGPRX2  Malacards:  MRGPRX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0043303	mast cell degranulation	IDA	biological process
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0045576	mast cell activation	IDA	biological process
GO:1990595	mast cell secretagogue receptor activity	ISS	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042629	mast cell granule	IEA	cellular component
GO:0016021	integral component of membrane	IC	cellular component
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0032467	positive regulation of cytokinesis	IMP	biological process
GO:0042923	neuropeptide binding	IPI	molecular function
GO:0030431	sleep	NAS	biological process
GO:0019233	sensory perception of pain	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881