Search Result
| Gene id | 116969 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | ART5 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | ARTC5 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | ADP-ribosyltransferase 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | ecto-ADP-ribosyltransferase 5, ADP-ribosyltransferase C2 and C3 toxin-like 5, NAD(P)(+)--arginine ADP-ribosyltransferase 5, mono(ADP-ribosyl)transferase 5, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
11p15.4 (3642391: 3638502) Exons: 7 NC_000011.10 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolo |
||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 612905 | ||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q96L15 Name: Ecto ADP ribosyltransferase 5 (EC 2.4.2.31) (ADP ribosyltransferase C2 and C3 toxin like 5) (ARTC5) (Mono(ADP ribosyl)transferase 5) (NAD(P)(+) arginine ADP ribosyltransferase 5) Length: 291 Mass: 32054 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MALAALMIALGSLGLHTWQAQAVPILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAHHALLRESWEAAQETW EDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLRGSGGC SRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSVFPKEREVLIP PHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMTKRHLQQP | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: ART5  Malacards: ART5 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||